Loading...
Statistics
Advertisement

teamarena.pl - strona hostowana na MyDevil.net
www.teamarena.pl/
teamarena.pl - strona hostowana na MyDevil.net

Teamarena.pl

Advertisement
Conversion Technology Metas Server
Teamarena.pl is hosted in Poland . Teamarena.pl uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Html5, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx.

Technologies in use by Teamarena.pl

Technology

Number of occurences: 3
  • CSS
  • Html
  • Html5

Advertisement

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Teamarena.pl

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Wildcard/CN=*.usermd.net
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Wildcard
      • CN: *.usermd.net
    • hash: 1c2d7892
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 243592083132030865962549176249911273102
    • validFrom: 150907000000Z
    • validTo: 161205235959Z
    • validFrom_time_t: 1441584000
    • validTo_time_t: 1480982399
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: BF:B3:87:CA:5A:80:17:92:51:BD:82:19:04:27:1A:04:8F:61:92:F9
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.usermd.net, DNS:usermd.net

Meta - Teamarena.pl

Number of occurences: 2
  • Name:
    Content:
  • Name: description
    Content: teamarena.pl - strona hostowana na MyDevil.net

Server / Hosting

  • IP: 31.186.82.38
  • Latitude: 52.24
  • Longitude: 21.04
  • Country: Poland

Rname

  • dns2.mydevil.net
  • dns1.mydevil.net
  • mail5.mydevil.net

Target

  • admin.admin.net.pl

HTTP Header Response

HTTP/1.1 200 OK Server: nginx Date: Fri, 01 Jul 2016 16:55:25 GMT Content-Type: text/html Content-Length: 4035 Last-Modified: Wed, 16 Sep 2015 03:52:17 GMT Accept-Ranges: bytes ETag: "55f8e771-fc3" Accept-Ranges: bytes X-Cache: MISS from s_mf15 X-Cache-Lookup: MISS from s_mf15:80 Via: 1.1 s_mf15 (squid/3.5.6) Connection: keep-alive

DNS

host: teamarena.pl
  1. class: IN
  2. ttl: 3597
  3. type: A
  4. ip: 31.186.82.38
host: teamarena.pl
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns2.mydevil.net
host: teamarena.pl
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns1.mydevil.net
host: teamarena.pl
  1. class: IN
  2. ttl: 1200
  3. type: SOA
  4. mname: dns1.mydevil.net
  5. rname: admin.admin.net.pl
  6. serial: 2015130002
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 10800
host: teamarena.pl
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mail5.mydevil.net
host: teamarena.pl
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: v=spf1 mx a include:mail5.mydevil.net -all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.eamarena.pl, www.tqeamarena.pl, www.qeamarena.pl, www.taeamarena.pl, www.aeamarena.pl, www.t eamarena.pl, www. eamarena.pl, www.tweamarena.pl, www.weamarena.pl, www.teeamarena.pl, www.eeamarena.pl, www.tzeamarena.pl, www.zeamarena.pl, www.txeamarena.pl, www.xeamarena.pl, www.tceamarena.pl, www.ceamarena.pl, www.tamarena.pl, www.texamarena.pl, www.txamarena.pl, www.tesamarena.pl, www.tsamarena.pl, www.tewamarena.pl, www.twamarena.pl, www.teramarena.pl, www.tramarena.pl, www.tefamarena.pl, www.tfamarena.pl, www.tevamarena.pl, www.tvamarena.pl, www.tecamarena.pl, www.tcamarena.pl, www.teqamarena.pl, www.tqamarena.pl, www.teaamarena.pl, www.taamarena.pl, www.teyamarena.pl, www.tyamarena.pl, www.temarena.pl, www.teaomarena.pl, www.teomarena.pl, www.teapmarena.pl, www.tepmarena.pl, www.tea9marena.pl, www.te9marena.pl, www.teamarena.pl, www.temarena.pl, www.teaimarena.pl, www.teimarena.pl, www.teaumarena.pl, www.teumarena.pl, www.teaarena.pl, www.teamparena.pl, www.teaparena.pl, www.teamoarena.pl, www.teaoarena.pl, www.teamiarena.pl, www.teaiarena.pl, www.teamkarena.pl, www.teakarena.pl, www.team.arena.pl, www.tea.arena.pl, www.teamuarena.pl, www.teauarena.pl, www.teamjarena.pl, www.teajarena.pl, www.teamnarena.pl, www.teanarena.pl, www.team-arena.pl, www.tea-arena.pl, www.teamrena.pl, www.teamaorena.pl, www.teamorena.pl, www.teamaprena.pl, www.teamprena.pl, www.teama9rena.pl, www.team9rena.pl, www.teamarena.pl, www.teamrena.pl, www.teamairena.pl, www.teamirena.pl, www.teamaurena.pl, www.teamurena.pl, www.teamaena.pl, www.teamariena.pl, www.teamaiena.pl, www.teamaroena.pl, www.teamaoena.pl, www.teamarlena.pl, www.teamalena.pl, www.teamarlena.pl, www.teamalena.pl, www.teamar.ena.pl, www.teama.ena.pl, www.teamarna.pl, www.teamarexna.pl, www.teamarxna.pl, www.teamaresna.pl, www.teamarsna.pl, www.teamarewna.pl, www.teamarwna.pl, www.teamarerna.pl, www.teamarrna.pl, www.teamarefna.pl, www.teamarfna.pl, www.teamarevna.pl, www.teamarvna.pl, www.teamarecna.pl, www.teamarcna.pl, www.teamareqna.pl, www.teamarqna.pl, www.teamareana.pl, www.teamarana.pl, www.teamareyna.pl, www.teamaryna.pl, www.teamarea.pl, www.teamarenna.pl, www.teamarena.pl, www.teamarenha.pl, www.teamareha.pl, www.teamarenja.pl, www.teamareja.pl, www.teamarenka.pl, www.teamareka.pl, www.teamarenla.pl, www.teamarela.pl, www.teamaren a.pl, www.teamare a.pl, www.teamaren.pl, www.teamarenao.pl, www.teamareno.pl, www.teamarenap.pl, www.teamarenp.pl, www.teamarena9.pl, www.teamaren9.pl, www.teamarena.pl, www.teamaren.pl, www.teamarenai.pl, www.teamareni.pl, www.teamarenau.pl, www.teamarenu.pl,

Other websites we recently analyzed

  1. Home - Precious Paws and Claws
    Precious Paws and Claws is a small family pet crematory secializing in private pet cremation.
    Wayne (United States) - 74.208.253.220
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 4
  2. Lodge Justitia No.82
    India - 103.14.121.95
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, Swf Object
    Number of Javascript: 1
    Number of meta tags: 1
  3. readmansions.co.uk
    Gloucester (United Kingdom) - 88.208.252.9
    Server software: Microsoft-IIS/7.0
    Technology: Html
    Number of meta tags: 2
  4. Reload.LK - Reload/Recharge Prepaid Mobiles Online
    Kiel (Germany) - 83.125.22.184
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery, Php, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 1
  5. insurancecomments.com
    Houston (United States) - 192.185.29.249
    Server software: nginx/1.10.0
    Technology: Html
    Number of meta tags: 2
  6. hg57777.com
    hg57777.com
    Las Vegas (United States) - 70.39.84.241
    Server software:
    Technology: CSS, jQuery
    Number of Javascript: 1
    Number of meta tags: 4
  7. William & Brandi sittin' in a tree..
    William & Brandi's Wedding - August 21st Gale Woods Farm
    Culver City (United States) - 205.186.183.161
    Server software: Apache/2.2.22
    Technology: CSS, Google Font API, Html, Iframe, Javascript, Google Analytics, Wordpress
    Number of Javascript: 4
    Number of meta tags: 4
  8. Portail SCPI OPCI : Conseils d’experts pour investir
    Primaliance, le 1er portail dédié aux SCPI de rendement, SCPI fiscales et aux OPCI : toute l’information, les offres et les conseils pour bien investir.
    France - 46.105.42.212
    Server software: Apache/2.2.16 (Debian)
    Technology: DoubleClick.Net, CSS, Fancybox, Font Awesome, Google Font API, Html, Javascript, jQuery Cookie, jQuery Cycle, jQuery Fancybox, Google Analytics, Google AdWords Conversion Tracking, Google Remarketing, Facebook Box, Google +1 Button
    Number of Javascript: 19
    Number of meta tags: 6
  9. familievakantiekleinwalsertal.nl - Home
    Appartement in het Kleinwalsertal. Leuk appartement te huur in het Aparthotel in Kleinwalsertal. Beleef een heerlijke vakantie met het hele gezin. Winter of zomer, er is altijd wat te doen.
    Netherlands - 93.94.226.163
    Server software: Apache
    Technology: CSS, Html, Php
    Number of meta tags: 4
  10. Wix.com wadeswestern created by amandajeffries based on nu-classic-com
    , Home , Lorem ipsum dolor sit amet consectetuer , Lorem ipsum dolor sit amet consectetuer adipiscing elit Suspendisse et dolor vel arcu rhoncus varius Ut massa Praesent vel pede in dui blandit volutpat.Vestib ulum
    Ashburn (United States) - 52.202.41.232
    Server software: Sun-ONE-Web-Server/6.1
    Technology: CSS, Html, Iframe, Javascript, New Relic, Wix, Facebook Box
    Number of Javascript: 4
    Number of meta tags: 6

Check Other Websites